• Aucun résultat trouvé

RB481, RB482, RB483, RB484, RB485, RB486, RB498 and RB499 antibodies recognize the coatomer COPI complex by ELISA

N/A
N/A
Protected

Academic year: 2022

Partager "RB481, RB482, RB483, RB484, RB485, RB486, RB498 and RB499 antibodies recognize the coatomer COPI complex by ELISA"

Copied!
3
0
0

Texte intégral

(1)

Article

Reference

RB481, RB482, RB483, RB484, RB485, RB486, RB498 and RB499 antibodies recognize the coatomer COPI complex by ELISA

HAMMEL, Philippe

Abstract

The recombinant antibodies RB481, RB482, RB483, RB484, RB485, RB486, RB498 and RB499 detect by ELISA a purified COPI complex from COS7 cells.

HAMMEL, Philippe. RB481, RB482, RB483, RB484, RB485, RB486, RB498 and RB499 antibodies recognize the coatomer COPI complex by ELISA. Antibody Reports , 2020, vol. 3, no. 2, p. e139

DOI : 10.24450/journals/abrep.2020.e139

Available at:

http://archive-ouverte.unige.ch/unige:134096

Disclaimer: layout of this document may differ from the published version.

1 / 1

(2)

doi:10.24450/journals/abrep.2020.e139 Antibody Reports, 2020, vol. 3, e139

This work is licensed under a Creative Commons Attribution 4.0 International License.

Geneva University Library Open Access Publications https://oap.unige.ch/journals/abrep | ISSN 2624-8557

RB481, RB482, RB483, RB484, RB485, RB486, RB498 and RB499 antibodies recognize the coatomer COPI complex by ELISA

Philippe Hammel

Geneva Antibody Facility, Faculty of Medicine, University of Geneva, 1 rue Michel Servet, CH-1211, Geneva, Switzerland

Abstract

The recombinant antibodies RB481, RB482, RB483, RB484, RB485, RB486, RB498 and RB499 detect by ELISA a purified COPI complex from COS7 cells.

Introduction

COPI (Coatomer or COat Protein complex I) is a large polypeptide complex (composed of seven different subunits) involved in retrograde traffic from the Golgi apparatus to the endoplasmic reticulum (Cosson and Letourneur, 1994). Here we describe the ability of eight recombinant antibodies (RB481, RB482, RB483, RB484, RB485, RB486, RB498 and RB499) to detect by ELISA a purified COPI complex from COS7 cells.

Materials & Methods

Antibodies: ABCD_RB481, ABCD_RB482, ABCD_RB483, ABCD_RB484, ABCD_RB485, ABCD_RB486, ABCD_RB498 and ABCD_RB499 antibodies (ABCD nomenclature, https://web.expasy.org/

abcd/) were produced by the Geneva Antibody Facility (www.unige.ch/medecine/antibodies/; Blanc et al., 2014) as mini-antibodies with the antigen-binding scFv portion fused to a rabbit IgG Fc (RRB481, RRB482, RRB483, RRB484, RRB484, RRB485, RRB486, RRB498 and RRB499). HEK293 suspension cells (growing in FreeStyle™ 293 Expression Medium, Gibco #12338) were transiently transfected with the vector coding for the scFv-Fc of each antibody. Supernatants (~50 mg/L) were collected after 5 days.

Antigen: The antibodies were raised against a pulled- down COPI complex from COS7 cells (Fig. 1). Briefly, synthetic N-terminally biotinylated peptides KKLETFKKTN or KKLETFSSTN were immobilized at saturating concentration on Dynabeads® M-280 Streptavidin (Invitrogen #11205D). COS7 cells were lysed in Hepes-Triton buffer [50 mM Hepes (pH 7.3), 90 mM KCl, 0.5% Triton X100 and protease inhibitors] at 4x106 cells/ml. 1 mg of beads (approximately 200 pmoles of peptide) were incubated with 1 ml of COS7 cell lysate.

After incubation (2 h at 4 °C), beads were washed 3 times in Hepes-Triton buffer and once in 50 mM Hepes. To analyze the proteins bound to the beads, samples were boiled in reducing sample buffer [20.6% (w/v) sucrose, 100 mM Tris pH 6.8, 10 mM EDTA, 0.1% (w/v) bromophenol blue, 4% (w/v) SDS, 6% (v/v) b- mercaptoethanol] and run on a 4-15% acrylamide gel (Mini-PROTEAN® TGX™ Precast Gel, Biorad #456- 1086). The gel (Fig. 1) was stained using PageBlue Staining Solution (Thermo Scientific #24620). Antibodies were raised against the KKLETFKKTN peptide (the last

10 C-terminal residues from yeast WBP1; Uniprot

#P33767); KKLETFSSTN was used as a negative selection during phage display panning and as negative control for ELISA.

Protocol: Biotinylated KKLETFKKTN and KKLETFSSTN peptides at saturating concentration (10 pmol/well) were immobilized on streptavidin-coated ELISA plates (Pierce #15124) for 30 min. Each well was rinsed three times with 100 µl of washing buffer (PBS + 0.5% (w/v) BSA + 0.05% (w/v) Tween20), then incubated for 2 hour with 50 µl of COS7 cell lysate prepared in the same conditions as for the pull down (every antibody was also tested against a KKLETFKKTN peptide not incubated with COS7 cell lysate). After 3 washes with washing buffer, wells were incubated for 1 hour with 50 µl of RRB antibody-containing supernatant diluted in washing buffer (Fig. 2). After rinsing 3 times (100 µl washing buffer), wells were incubated with horseradish peroxidase-coupled goat anti-rabbit IgG (Sigma #A8275, dilution 1:1000, 50 µl per well) for 30 min. After 3 rinses, Tetramethylbenzidine (TMB) substrate (Sigma #T5569) was added (50 µl per well). The reaction was stopped by the addition of 25 µl of 2 M H2SO4. The absorbance (OD) was measured at 450 nm, and the absorbance at 570 nm was subtracted.

Results

Antibodies RRB481, RRB482, RRB483, RRB484, RRB484, RRB485, RRB486, RRB498 and RRB499 bound in a concentration-dependent manner to the KKLETFKKTN peptide loaded with COS7 cell lysate against which they were raised, but not to the unloaded KKLETFKKTN peptide, nor to the KKLETFSSTN peptide loaded with COS7 cell lysate (Fig. 2). For some of the antibodies the binding was strong (RB481, RB482, RB484, RB486), while it was weaker, but detectable, for all other antibodies tested.

References

Blanc C, Zufferey M, Cosson P. Use of in vivo biotinylated GST fusion proteins to select recombinant antibodies. ALTEX. 2014; 31(1):37-42. PMID:24100547 Cosson P, Letourneur F. Coatomer interaction with di- lysine endoplasmic reticulum retention motifs. Science 1994; 263(5153):1629-31. PMID:8128252.

Conflict of interest

The authors declare no conflict of interest.

(3)

doi:10.24450/journals/abrep.2020.e139 Antibody Reports, 2020, vol. 3, e139

Fig.1. The KKLETFKKTN peptide pulls down the COS7 COPI complex: subunits *alpha 170 kDa, **beta, betaprime and gamma 98- 110 kDa, ***delta 61 kDa (lane 1). The KKLETFSSTN peptide pull down is shown as control (lane 2)

Fig. 2. Specific binding of RRB antibodies to the target KKLETFKKTN peptide loaded with COS7 cell lysate (i.e. COPI complex), as detected by ELISA. SSTN indicates the binding of RRB481 to the KKLETFSSTN peptide loaded with COS7 cell lysate and KKTN indicates binding of the same antibody to the unloaded KKLETFKKTN(all other control curves were superimposed).

1:100 1:1000 1:10000

Antibody Dilution

ELISA signal (OD)

0.00 0.05 0.10 0.15 0.20

SSTN KKTN

RB481 RB482 RB483

RB484 RB485 RB486 RB498 RB499

Références

Documents relatifs

The antibody RB487 bound in a concentration-dependent manner to the WBP1 peptide against which they were raised (KKLETFKKTN), but not to the negative control

Antibodies MRB155, MRB156 and MRB189 bound in a concentration-dependent manner to the GST-Tsg101 antigen, but not to the GST negative control (Fig. Note that this antigen

The recombinant antibodies RB252, RB253, RB254 and RB255 detect by ELISA the human Miner1/CISD2 fused to a GST protein.. HAMMEL, Philippe,

The recombinant antibodies RB501, RB502, RB503, RB504 and RB505 detect by ELISA the human Protein unc-93 homolog B1fused to a GST protein.. WANG, Jennifer Wen-An,

The recombinant antibodies RB436, RB437 and RB439 detect by ELISA a synthetic peptide from the Dictyostelium Nup133 protein.. HAMMEL, Philippe, LIMA,

As a negative control, an N-biotinylated peptide corresponding to the last 33 C-terminal residues ( DSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ ) of the SARS- CoV-2 M protein

The recombinant antibodies RA11 and RA12 detect by western blot a peptide of the Dictyostelium discoideum Mucolipin protein fused to a GST protein.. ZUFFEREY, Madeleine,

The recombinant antibodies RB481, RB482, RB483, RB484, RB485, RB486, RB498 and RB499 detect by immunofluorescence the COPI complex in paraformaldehyde-fixed cells COS7