• Aucun résultat trouvé

RB501, RB502, RB503, RB504 and RB505 antibodies recognize the human UNC93B1 protein by ELISA

N/A
N/A
Protected

Academic year: 2022

Partager "RB501, RB502, RB503, RB504 and RB505 antibodies recognize the human UNC93B1 protein by ELISA"

Copied!
2
0
0
En savoir plus ( Page)

Texte intégral

(1)

Article

Reference

RB501, RB502, RB503, RB504 and RB505 antibodies recognize the human UNC93B1 protein by ELISA

WANG, Jennifer Wen-An, DEMAUREX, Nicolas

Abstract

The recombinant antibodies RB501, RB502, RB503, RB504 and RB505 detect by ELISA the human Protein unc-93 homolog B1fused to a GST protein.

WANG, Jennifer Wen-An, DEMAUREX, Nicolas. RB501, RB502, RB503, RB504 and RB505 antibodies recognize the human UNC93B1 protein by ELISA. Antibody Reports , 2019, vol. 2, no. 2, p. e40

DOI : 10.24450/journals/abrep.2019.e40

Available at:

http://archive-ouverte.unige.ch/unige:119406

Disclaimer: layout of this document may differ from the published version.

1 / 1

(2)

doi:10.24450/journals/abrep.2019.e40 Antibody Reports, 2019, vol. 2, e40

This work is licensed under a Creative Commons Attribution 4.0 International License.

Geneva University Library Open Access Publications https://oap.unige.ch/journals/abrep | ISSN 2624-8557

RB501, RB502, RB503, RB504 and RB505 antibodies recognize the human UNC93B1 protein by ELISA

Jennifer Wen-An Wang, Nicolas Demaurex

Dept. of Physiology and Metabolism, Faculty of Medicine, University of Geneva, 1 rue Michel Servet, CH-1211, Geneva, Switzerland

Abstract

The recombinant antibodies RB501, RB502, RB503, RB504 and RB505 detect by ELISA the human Protein unc-93 homolog B1fused to a GST protein.

Introduction

The protein uncoordinated 93 homolog B1 (UNC93B1, Uniprot #Q9H1C4) is a human twelve-transmembrane protein localized in the endoplasmic reticulum membrane and endosomal compartments (Maschalidi et al., 2017).

Here we describe the ability of five recombinant antibodies (RB501, RB502, RB503, RB504 and RB505) to detect by ELISA a GST-fused UNC93B1 protein.

Materials & Methods

Antibodies: ABCD_RB501, ABCD_RB502, ABCD_RB503, ABCD_RB504 and ABCD_RB505 antibodies (ABCD nomenclature, web.expasy.org/abcd/) were produced by the Geneva Antibody Facility (www.unige.ch/medecine/antibodies/; Blanc et al., 2014) as mini-antibodies with the antigen-binding scFv fused to a rabbit IgG Fc (RRB501, RRB502, RRB503, RRB504, RRB505). HEK293 suspension cells (growing in FreeStyle™ 293 Expression Medium, Gibco #12338) were transiently transfected with the vectors coding for each scFv-Fc. Supernatants (~20-100 mg/l) were collected after 5 days.

Antigen: The antibodies were originally raised against a GST protein fused to the residues 2-63 of UNC93B1. This chimeric in vivo biotinylated GST-UNC93B1 was used as antigen for ELISA detection. GST was used as negative control.

Protocol: The whole procedure was carried out at room temperature. Bacterial lysates containing GST proteins were incubated in a streptavidin-coated ELISA plates (Pierce #15124) for 30 min at 4°C. Each well was rinsed three times with 100 µl of washing buffer (PBS + 0.5%

(w/v) BSA + 0.05% (w/v) Tween20), then incubated for 1 hour with 50 µl of RRB antibody-containing supernatant diluted in washing buffer (Fig. 1). After rinsing 3 times (100 µl washing buffer), wells were incubated with horseradish peroxidase-coupled goat anti-rabbit IgG (Bio- Rad #170-6516, dilution 1:1000, 50 µl per well) for 30 min. After 3 rinses, Tetramethylbenzidine (TMB) substrate (Sigma #T5569) was added (50 µl per well). The

reaction was stopped by the addition of 25 µl of 2 M H2SO4. The absorbance (OD) was measured at 450 nm, and the absorbance at 570 nm was subtracted.

Results

Antibodies RRB501, RRB502, RRB503, RRB504 and RRB505 bound in a concentration-dependent manner to the GST-UNC93B1 antigen, but not to the GST negative control (Fig. 1).

Fig. 1. Specific binding of RRB antibodies to the target GST-UNC93B1 protein, as detected by ELISA. ‘Control’ indicates the binding of RRB501 to GST (all other control curves were superimposed).

References

Blanc C, Zufferey M, Cosson P. Use of in vivo biotinylated GST fusion proteins to select recombinant antibodies. ALTEX. 2014; 31(1):37-42. PMID:24100547 Maschalidi S, Nunes-Hasler P, Nascimento CR, et al.

UNC93B1 interacts with the calcium sensor STIM1 for efficient antigen cross-presentation in dendritic cells. Nat Commun. 2017; 8(1):1640. PMID:29158474

Conflict of interest

The authors declare no conflict of interest.

0.0 0.5 1.0 1.5

1:100 1:1000 1:10000

ELISA Signal (OD)

Antibody Dilution

Control RB501 RB502 RB503 RB504 RB505

Références

Documents relatifs

AF394, AF395 and AF396 labeled the plasma membrane of HeLa cells expressing the GFP-tagged TAC protein (in white); the signal co-localized (arrows) with the signal generated by the

(A) AI239 and MRB95 labeled the plasma membrane of HeLa cells expressing the GST-tagged TAC protein (in white); the signal co-localized (arrows) with the signal generated by

AE391 and AF291 labeled the plasma membrane of HeLa cells expressing the HA-tagged TAC protein (in white); the signal co- localized (arrows) with the signal generated by the

AD946 (despite its low production yield) and AF371 antibodies specifically detected a signal at the plasma membrane in cells transfected with the His-tagged TAC

(A) AF166 and AI179 labeled the plasma membrane of HeLa cells expressing the Myc-tagged TAC protein (in white); the signal co-localized (arrows) with the signal generated by

Antibodies MRB155, MRB156 and MRB189 bound in a concentration-dependent manner to the GST-Tsg101 antigen, but not to the GST negative control (Fig. Note that this antigen

AR222, AR249, AS274, AS702 and AS708 antibodies recognize the spike S protein from SARS-CoV-2 by ELISA.. HAMMEL, Philippe, MARCHETTI, Anna,

The recombinant antibodies RB252, RB253, RB254 and RB255 detect by ELISA the human Miner1/CISD2 fused to a GST protein.. HAMMEL, Philippe,

The recombinant antibodies RB252, RB253, RB254 and RB255 detect by immunofluorescence the human Miner1 protein in paraformaldehyde-fixed cells.. MARCHETTI, Anna, LIMA,

The recombinant antibodies AF394 and AF395 detect by Western blot the GFP-AlyL protein from Dictyostelium discoideum.. AF396

The recombinant antibodies RB376 and RB377 detect by Western blot the full-length AlyA protein from Dictyostelium discoideum.. RB376 and RB377 antibodies recognize the

The recombinant antibodies RB447, RB452 and RB453 detect by ELISA the Dictyostelium AlyL fused to a GST protein.. HAMMEL, Philippe, JAUSLIN, Tania,

The recombinant antibodies AI239, RB94 and RB95 detect by ELISA the Glutathione S-transferase (GST) protein..

The recombinant antibodies RB519, RB520, RB521 and RB522 detect by ELISA the human ISOC1 fused to a GST protein.. CLÉMENT LEBOUBE, Sophie,

The recombinant antibodies RB250 and RB251 detect by ELISA the human MitoNEET/CISD1 fused to a GST protein.. HAMMEL, Philippe,

The recombinant antibodies RB196 and RB197 detect by ELISA a fragment of the RdRp region of the hepatitis E virus ORF1 protein fused to a GST protein..

The recombinant antibodies RB198, RB199 and RB200 detect by ELISA a fragment of the hepatitis E virus ORF3 protein fused to a GST protein..

The recombinant antibodies RB172 and RB173 detect by ELISA a fragment of the Dictyostelium discoideum Conditioned Medium Factor (CMF) fused to a GST protein..

The recombinant antibodies RB174, RB175, RB176, RB177 and RB178 detect by ELISA a fragment of the Dictyostelium discoideum Conditioned Medium Factor (CMF) fused to a GST

Potent neutralization of severe acute respiratory syndrome (SARS) coronavirus by a human mAb to S1 protein that blocks receptor association.. Proc Natl Acad

We demonstrate here that recombinant antibodies RB137 and RB138 are specific for native LL37 and do not recognize modified LL37 (citrullinated and carbamylated).. They thus

Here we show that three monoclonal antibodies (RB139, RB141, and RB142) are exclusively specific for citrullinated LL37, whereas RB140 recognizes both native LL37 and cit-LL37..

As a negative control, an N-biotinylated peptide corresponding to the last 33 C-terminal residues ( DSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ ) of the SARS- CoV-2 M protein