• Aucun résultat trouvé

RB137 and RB138 antibodies recognize human cathelicidin LL37 by ELISA

N/A
N/A
Protected

Academic year: 2022

Partager "RB137 and RB138 antibodies recognize human cathelicidin LL37 by ELISA"

Copied!
3
0
0
En savoir plus ( Page)

Texte intégral

(1)

Article

Reference

RB137 and RB138 antibodies recognize human cathelicidin LL37 by ELISA

PALAZZO, Raffaella, et al.

Abstract

LL37 is a cationic antimicrobial peptide (AMP), which can undergo post-translational modifications (PTM), such as citrullination and carbamylation. We demonstrate here that recombinant antibodies RB137 and RB138 are specific for native LL37 and do not recognize modified LL37 (citrullinated and carbamylated). They thus represent tools to assess the presence of native, unmodified LL37 in body fluids by ELISA.

PALAZZO, Raffaella, et al . RB137 and RB138 antibodies recognize human cathelicidin LL37 by ELISA. Antibody Reports , 2020, vol. 3, no. 3, p. e188

DOI : 10.24450/journals/abrep.2020.e188

Available at:

http://archive-ouverte.unige.ch/unige:138774

Disclaimer: layout of this document may differ from the published version.

1 / 1

(2)

doi:10.24450/journals/abrep.2020.e188 Antibody Reports, 2020, vol. 3, e188

This work is licensed under a Creative Commons Attribution 4.0 International License.

Geneva University Library Open Access Publications https://oap.unige.ch/journals/abrep | ISSN 2624-8557

RB137 and RB138 antibodies recognize human cathelicidin LL37 by ELISA

Roberto Lande

1

, Raffaella Palazzo

1

, Immacolata Pietraforte

2

, Carlo Chizzolini

3

, Loredana Frasca

1,3

1 Istituto Superiore di Sanità, National Center for Drug Research and Evaluation, Viale Regina Elena 299, 00161, Rome, Italy 2 Istituto Superiore di Sanità, Department of Oncology and Molecular Medicine, Viale Regina Elena 299, 00161 Rome, Italy 3 Dept of Pathology and Immunology, Centre Médical Universitaire (CMU), Geneva University, 1 Rue Michel Servet, Geneva, Switzerland

Abstract

LL37 is a cationic antimicrobial peptide (AMP), which can undergo post-translational modifications (PTM), such as citrullination and carbamylation. We demonstrate here that recombinant antibodies RB137 and RB138 are specific for native LL37 and do not recognize modified LL37 (citrullinated and carbamylated). They thus represent tools to assess the presence of native, unmodified LL37 in body fluids by ELISA.

Introduction

Human cathelicidin antimicrobial peptide (CAP18 or FALL39, UniProt #P49913) is encoded by the human gene CAMP. The peptide LL37, which corresponds to the COOH-terminal part of the molecule (residues 134-170), represents the native form, which exerts antimicrobial and immune-modulatory activity (Zanetti, 2005; Hancock et al., 2016). Several native LL37 functions are altered by post-translational modifications (PTM), in particular if citrullination and/or carbamylation occur in response to inflammatory processes (Kilsgård et al., 2012; Koro et al., 2016). Here we analyzed the ability of two recombinant antibodies (RB137 and RB138) to detect specifically the native form of the LL37 peptide by ELISA.

Materials & Methods

Antibodies: ABCD_RB137 and ABCD_RB138 antibodies (ABCD nomenclature, https://web.expasy.org/

abcd/) were produced by the Geneva Antibody Facility (https://www.unige.ch/medecine/antibodies/) as mini- antibodies with the antigen-binding scFv portion fused to a mouse IgG2a Fc (MRB137 and MRB138). HEK293 adherent cells (growing in DMEM, Gibco #11960044 supplied with 8% FBS) were transiently transfected with the vectors coding for each scFv-Fc. Supernatants (~1-5 mg/l) were collected after 5 days.

Antigen: The antibodies were raised against an N- biotinylated synthetic native LL37 peptide ([LL-37, 37 aa]). This peptide was also used as antigen for ELISA detection. As a negative control, an N-biotinylated scrambled LL37 sequence was used, as well as an N-biotinylated citrullinated LL37 (cit-LL37), where the 5 arginines were replaced by 5 citrullines (LLGDFF-Cit-KSKEKIGKEFK-Cit- IVQ-Cit-IKDFL-Cit-NLVP-Cit-TES) and an N-

biotinylated carbamylated LL-37 (carb-LL37) (L*LGDFFRK*SK*EK*IG-K-EFK*RIVQRIK*DFLRNLVPRTES, in which the asterisks describe substitutions with homocitrullines) (Koro et al., 2016).

Protocol: The whole procedure was carried out at room temperature. Biotinylated peptides at saturating concentration (10 pmol/well) were immobilized on streptavidin-coated ELISA plates (Pierce #15124) for 30 min. Each well was rinsed three times with 100 µl of washing buffer (PBS + 0.5% (w/v) BSA + 0.05% (w/v) Tween20), then incubated for 1 hour with 50 µl of MRB antibody-containing supernatant diluted in washing buffer (Fig. 1). After rinsing 3 times (100 µl washing buffer), wells were incubated with horseradish peroxidase-coupled goat anti-mouse IgG (Bio-Rad #170-6516, dilution 1:1000, 50 µl per well) for 30 min. After 3 rinses, Tetramethylbenzidine (TMB) substrate (Sigma #T5569) was added (50 µl per well). The reaction was stopped by the addition of 25 µl of 2 M H2SO4. The absorbance (OD) was measured at 450 nm, and the absorbance at 570 nm was subtracted. For comparing reactivity of the antibodies to cit-LL37 and carb-LL37, non-biotinylated native LL37, cit-LL37 and carb-LL37 were directly coated on ELISA plates (Costar) and the procedure carried out as above.

Results

Antibodies RB137 and RB138 bound in a concentration- dependent manner to the native LL37 peptide (against which they were raised), but not to the negative control scrambled peptide (Fig. 1), nor to cit-LL37 or carb-LL37 (Fig. 2). RB137 has since been shown to recognize native LL37 in human tissue by immunofluorescence and immunohistochemistry (Lande et al., 2020).

(3)

doi:10.24450/journals/abrep.2020.e188 Antibody Reports, 2020, vol. 3, e188

This work is licensed under a Creative Commons Attribution 4.0 International License.

Geneva University Library Open Access Publications https://oap.unige.ch/journals/abrep | ISSN 2624-8557

Fig. 1. Specific binding of RB antibodies to the target native LL37 peptide (LL37), as detected by ELISA. ‘Scr’ indicates binding to scrambled LL37.

Fig. 2. Specific binding of RB antibodies to the target native LL37 peptide (LL37), as detected by ELISA. ‘cit-LL37’ indicates binding to citrullinated LL37 and ‘carb-LL37’ to carbamylated LL37.

References

Hancock RE, Haney EF, Gill EE. The immunology of host defence peptides: beyond antimicrobial activity. Nat Rev Immunol. 2016; 16:321-34. PMID:27087664

Kilsgård O, Andersson P, Malmsten M, et al.

Peptidylarginine deiminases present in the airways during tobacco smoking and inflammation can citrullinate the host defense peptide LL-37, resulting in altered activities.

Am J Respir Cell Mol Biol. 2012; 46:240-8. PMID:

21960546

Koro C, Hellvard A, Delaleu N, et al. Carbamylated LL- 37 as a modulator of the immune response. Innate Immun.

2016; 22:218-29. PMID:26878866

Lande R, Palazzo R, Gestermann N, et al. Native/

citrullinated LL37-specific T-cells help autoantibody production in Systemic Lupus Erythematosus. Sci Rep.

2020; 10:5851. PMID:32245990

Zanetti M. The role of cathelicidins in the innate host defenses of mammals. Curr. Issues Mol. Biol. 2005;

7:179-196. PMID:16053249

Conflict of interest

The authors declare no conflict of interest.

Funding

This work was supported by the following grants: Carlos and Elsie de Reuter Foundation, Centre Médical Universitaire, Geneva, Switzerland to L.F.; Ernst et Lucie Schmidheiny Foundation, Geneva, Switzerland to L.F;

Swiss National Found to C.C. (grant 310030–159999);

and National Psoriasis Foundation, USA (2019–2021) to L.F.

0.0 0.2 0.4 0.6

1:10 1:100 1:1000

ELISA Signal (OD)

Antibody Dilution MRB137

Scr LL37

0.0 0.5 1.0

1:10 1:100 1:1000

ELISA Signal (OD)

Antibody Dilution MRB138

Scr LL37

Références

Documents relatifs

Importantly, we identified abundant citrullinated LL37 (cit-LL37) in SLE tissues (skin and kidney) and observed very pronounced reactivity of LL37-specific SLE T-cells to

T-cells IL-17 production was also revealed by “Cytokine secretion assays kits” (MACS, Miltenyi), according to the Manufactur’s instructions in primary bulk cultures set-up with

AF394, AF395 and AF396 labeled the plasma membrane of HeLa cells expressing the GFP-tagged TAC protein (in white); the signal co-localized (arrows) with the signal generated by the

(A) AI239 and MRB95 labeled the plasma membrane of HeLa cells expressing the GST-tagged TAC protein (in white); the signal co-localized (arrows) with the signal generated by

AE391 and AF291 labeled the plasma membrane of HeLa cells expressing the HA-tagged TAC protein (in white); the signal co- localized (arrows) with the signal generated by the

AD946 (despite its low production yield) and AF371 antibodies specifically detected a signal at the plasma membrane in cells transfected with the His-tagged TAC

(A) AF166 and AI179 labeled the plasma membrane of HeLa cells expressing the Myc-tagged TAC protein (in white); the signal co-localized (arrows) with the signal generated by

The recombinant antibodies RB252, RB253, RB254 and RB255 detect by ELISA the human Miner1/CISD2 fused to a GST protein.. HAMMEL, Philippe,

The recombinant antibodies RB252, RB253, RB254 and RB255 detect by immunofluorescence the human Miner1 protein in paraformaldehyde-fixed cells.. MARCHETTI, Anna, LIMA,

The recombinant antibodies AF394 and AF395 detect by Western blot the GFP-AlyL protein from Dictyostelium discoideum.. AF396

The recombinant antibodies RB501, RB502, RB503, RB504 and RB505 detect by ELISA the human Protein unc-93 homolog B1fused to a GST protein.. WANG, Jennifer Wen-An,

The recombinant antibodies RB431, RB432, RB433, RB434, and RB435 detect by ELISA a synthetic peptide from the Dictyostelium RapA protein.. HAMMEL, Philippe, LIMA,

The recombinant antibodies RB436, RB437 and RB439 detect by ELISA a synthetic peptide from the Dictyostelium Nup133 protein.. HAMMEL, Philippe, LIMA,

The recombinant antibodies RB376, RB377 and RB378 detect by ELISA a synthetic peptide from the Dictyostelium AlyA protein.. HAMMEL, Philippe,

The recombinant antibodies RB464, RB465, RB466 and RB467 detect by ELISA a synthetic peptide from the Dictyostelium AlyA protein.. HAMMEL, Philippe,

The recombinant antibodies RB447, RB452 and RB453 detect by ELISA the Dictyostelium AlyL fused to a GST protein.. HAMMEL, Philippe, JAUSLIN, Tania,

The recombinant antibodies AI239, RB94 and RB95 detect by ELISA the Glutathione S-transferase (GST) protein..

The recombinant antibodies RB155, RB156 and RB189 do not detect by western blot the full-length Tsg101 protein from Dictyostelium discoideum.. LEUBA, Florence,

The recombinant antibodies RB519, RB520, RB521 and RB522 detect by ELISA the human ISOC1 fused to a GST protein.. CLÉMENT LEBOUBE, Sophie,

The recombinant antibodies RB250 and RB251 detect by ELISA the human MitoNEET/CISD1 fused to a GST protein.. HAMMEL, Philippe,

Abstract Recombinant antibodies RB110 and RB157 can be used in ELISA assays to specifically detect human CCR5 phosphorylated at serines 336/337 and at serine 349,

Potent neutralization of severe acute respiratory syndrome (SARS) coronavirus by a human mAb to S1 protein that blocks receptor association.. Proc Natl Acad

Here we show that three monoclonal antibodies (RB139, RB141, and RB142) are exclusively specific for citrullinated LL37, whereas RB140 recognizes both native LL37 and cit-LL37..