• Aucun résultat trouvé

RB155, RB156 and RB189 antibodies recognize a peptide from the D. discoideum Tsg101 protein by ELISA

N/A
N/A
Protected

Academic year: 2022

Partager "RB155, RB156 and RB189 antibodies recognize a peptide from the D. discoideum Tsg101 protein by ELISA"

Copied!
2
0
0
En savoir plus ( Page)

Texte intégral

(1)

Article

Reference

RB155, RB156 and RB189 antibodies recognize a peptide from the D. discoideum Tsg101 protein by ELISA

GERSTENMAIER, Lilli, HAGEDORN, Monica

Abstract

The recombinant antibodies RB155, RB156 and RB189 detect by ELISA a fragment of the D.

discoideum Tsg101 fused to a GST protein.

GERSTENMAIER, Lilli, HAGEDORN, Monica. RB155, RB156 and RB189 antibodies recognize a peptide from the D. discoideum Tsg101 protein by ELISA. Antibody Reports , 2020, vol. 3, no. 2, p. e143

DOI : 10.24450/journals/abrep.2020.e143

Available at:

http://archive-ouverte.unige.ch/unige:134100

Disclaimer: layout of this document may differ from the published version.

1 / 1

(2)

doi:10.24450/journals/abrep.2020.e143 Antibody Reports, 2020, vol. 3, e143

This work is licensed under a Creative Commons Attribution 4.0 International License.

Geneva University Library Open Access Publications https://oap.unige.ch/journals/abrep | ISSN 2624-8557

RB155, RB156 and RB189 antibodies recognize a peptide from the D. discoideum Tsg101 protein by ELISA

Lilli Gerstenmaier, Monica Hagedorn

Life Sciences and Chemistry, Jacobs University Bremen, Bremen, Germany

Abstract

The recombinant antibodies RB155, RB156 and RB189 detect by ELISA a fragment of the D. discoideum Tsg101 fused to a GST protein.

Introduction

The Dictyostelium discoideum Tsg101 (Tumor Susceptibility Gene 101, DDB_G0286797, UniProt

#Q54LJ3) is a component of the ESCRT-I complex, potentially involved in vesicular trafficking and sorting in endosomal compartments (Blanc et al., 2009). Here we describe the ability of three recombinant antibodies (RB155, RB156 and RB189) to detect by ELISA a fragment of the Tsg101 protein fused to a GST protein.

Materials & Methods

Antibodies: ABCD_RB155, ABCD_RB156 and ABCD_RB189 antibodies (ABCD nomenclature, web.expasy.org/abcd/; Lima et al., 2020) were produced by the Geneva Antibody Facility (www.unige.ch/

medecine/antibodies/; Blanc et al., 2014) as mini- antibodies with the antigen-binding scFv fused to a mouse IgG2A Fc (MRB155, MRB156 and MRB189). HEK293 suspension cells (growing in DMEM, Gibco #11960044 supplied with 8%FBS) were transiently transfected with the vectors coding for each scFv-Fc. Supernatants (~1-5 mg/l) were collected after 5 days.

Antigen: The antibodies were originally raised against a GST protein fused to the 20 first residues of Tsg101 (MYGHHGYPMHAHQQQMVNPT). This chimeric GST- Tsg101 was used as antigen for ELISA detection. GST was used as negative control.

Protocol: The whole procedure was carried out at room temperature. Bacterial lysates containing GST proteins were incubated in a glutathione-coated 96-well plate (Pierce #15240) for 30 min. Each well was rinsed three times with 100 µl of washing buffer (PBS + 0.5% (w/v) BSA + 0.05% (w/v) Tween20), then incubated for 1 hour with 50 µl of MRB antibody-containing supernatant diluted in washing buffer (Fig. 1). After rinsing 3 times (100 µl washing buffer), wells were incubated with horseradish peroxidase-coupled goat anti-mouse IgG (Bio-Rad #170-6516, dilution 1:1000, 50 µl per well) for 30 min. After 3 rinses, Tetramethylbenzidine (TMB) substrate (Sigma #T5569) was added (50 µl per well). The reaction was stopped by the addition of 25 µl of 2 M H2SO4. The absorbance (OD) was measured at 450 nm, and the absorbance at 570 nm was subtracted.

Results

Antibodies MRB155, MRB156 and MRB189 bound in a concentration-dependent manner to the GST-Tsg101 antigen, but not to the GST negative control (Fig. 1).

Note that this antigen only encompasses a small portion of the Tsg101 protein, and that it is presumably not properly folded. Further experiments will be necessary to determine if and in what conditions these antibodies recognize the full Tsg101 protein.

Fig. 1. Specific binding of MRB antibodies to the target GST-Tsg101 protein, but not to GST (shown only for MRB155; MRB156 and MRB189 background curves are superimposed), as detected by ELISA.

References

Blanc C, Charette SJ, Mattei S, Aubry L, Smith EW, Cosson P, Letourneur F. Dictyostelium Tom1 participates to an ancestral ESCRT-0 complex. Traffic. 2009;

10(2):161-71. PMID: 19054384

Blanc C, Zufferey M, Cosson P. Use of in vivo biotinylated GST fusion proteins to select recombinant antibodies. ALTEX. 2014;31(1):37-42. PMID:24100547 Lima WC, Gasteiger E, Marcatili P, Duek P, Bairoch A, Cosson P. The ABCD database: a repository for chemically defined antibodies. Nucleic Acids Res. 2020;

48(D1):D261-D264. PMID:31410491

Conflict of interest

The authors declare no conflict of interest.

0.0 0.5 1.0 1.5

1:10 1:100 1:1000

ELISA Signal (OD)

Antibody Dilution

Control RB155 RB156 RB189

Références

Documents relatifs

Recombinant antibodies RB039, RB040 and RB042 detect by western blot a peptide of the Dictyostelium discoideum NoxB protein fused to a GST protein.. ZUFFEREY, Madeleine,

Recombinant antibodies RB014, RB015 and RB016 detect by western blot a peptide of the Dictyostelium discoideum Phg1a protein fused to a GST protein.. ZUFFEREY, Madeleine,

Recombinant antibodies RB045 and RB048 detect by western blot a peptide of the Dictyostelium discoideum SibA protein fused to a GST protein.. ZUFFEREY, Madeleine,

The recombinant antibodies RB198, RB199 and RB200 detect by ELISA a fragment of the hepatitis E virus ORF3 protein fused to a GST protein..

Recombinant antibodies RA043 and RA044 detect by western blot a peptide of the Dictyostelium discoideum SibC protein fused to a GST protein.. ZUFFEREY, Madeleine,

The recombinant antibodies RB172 and RB173 detect by ELISA a fragment of the Dictyostelium discoideum Conditioned Medium Factor (CMF) fused to a GST protein..

The recombinant antibodies RB174, RB175, RB176, RB177 and RB178 detect by ELISA a fragment of the Dictyostelium discoideum Conditioned Medium Factor (CMF) fused to a GST

Potent neutralization of severe acute respiratory syndrome (SARS) coronavirus by a human mAb to S1 protein that blocks receptor association.. Proc Natl Acad

As a negative control, an N-biotinylated peptide corresponding to the last 33 C-terminal residues ( DSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ ) of the SARS- CoV-2 M protein

The recombinant antibodies RA11 and RA12 detect by western blot a peptide of the Dictyostelium discoideum Mucolipin protein fused to a GST protein.. ZUFFEREY, Madeleine,

(A) AI239 and MRB95 labeled the plasma membrane of HeLa cells expressing the GST-tagged TAC protein (in white); the signal co-localized (arrows) with the signal generated by

The recombinant antibodies AI842, AI843, AI844 and AI177 failed to detect by immunofluorescence a C-terminally FLAG-tagged LmpA fusion protein expressed in Dictyostelium

The recombinant antibodies RB252, RB253, RB254 and RB255 detect by ELISA the human Miner1/CISD2 fused to a GST protein.. HAMMEL, Philippe,

The recombinant antibodies RB501, RB502, RB503, RB504 and RB505 detect by ELISA the human Protein unc-93 homolog B1fused to a GST protein.. WANG, Jennifer Wen-An,

The recombinant antibodies RB431, RB432, RB433, RB434, and RB435 detect by ELISA a synthetic peptide from the Dictyostelium RapA protein.. HAMMEL, Philippe, LIMA,

The recombinant antibodies RB436, RB437 and RB439 detect by ELISA a synthetic peptide from the Dictyostelium Nup133 protein.. HAMMEL, Philippe, LIMA,

The recombinant antibodies RB376, RB377 and RB378 detect by ELISA a synthetic peptide from the Dictyostelium AlyA protein.. HAMMEL, Philippe,

The recombinant antibodies RB464, RB465, RB466 and RB467 detect by ELISA a synthetic peptide from the Dictyostelium AlyA protein.. HAMMEL, Philippe,

The recombinant antibodies RB447, RB452 and RB453 detect by ELISA the Dictyostelium AlyL fused to a GST protein.. HAMMEL, Philippe, JAUSLIN, Tania,

The recombinant antibodies AI239, RB94 and RB95 detect by ELISA the Glutathione S-transferase (GST) protein..

The recombinant antibodies RB155, RB156 and RB189 do not detect by western blot the full-length Tsg101 protein from Dictyostelium discoideum.. LEUBA, Florence,

The recombinant antibodies RB519, RB520, RB521 and RB522 detect by ELISA the human ISOC1 fused to a GST protein.. CLÉMENT LEBOUBE, Sophie,

The recombinant antibodies RB250 and RB251 detect by ELISA the human MitoNEET/CISD1 fused to a GST protein.. HAMMEL, Philippe,