• Aucun résultat trouvé

The RB596 antibody recognizes the spike S protein from SARS-CoV-2 by ELISA

N/A
N/A
Protected

Academic year: 2022

Partager "The RB596 antibody recognizes the spike S protein from SARS-CoV-2 by ELISA"

Copied!
2
0
0

Texte intégral

(1)

Article

Reference

The RB596 antibody recognizes the spike S protein from SARS-CoV-2 by ELISA

HAMMEL, Philippe, et al.

Abstract

The recombinant antibody RB596 detects by ELISA the spike S protein from SARS-CoV-2.

HAMMEL, Philippe, et al . The RB596 antibody recognizes the spike S protein from SARS-CoV-2 by ELISA. Antibody Reports , 2020, vol. 3, no. 3, p. e218

DOI : 10.24450/journals/abrep.2020.e218

Available at:

http://archive-ouverte.unige.ch/unige:138779

Disclaimer: layout of this document may differ from the published version.

1 / 1

(2)

doi:10.24450/journals/abrep.2020.e218 Antibody Reports, 2020, vol. 3, e218

This work is licensed under a Creative Commons Attribution 4.0 International License.

Geneva University Library Open Access Publications https://oap.unige.ch/journals/abrep | ISSN 2624-8557

The RB596 antibody recognizes the spike S protein from SARS-CoV-2 by ELISA

Philippe Hammel1, Kelvin Lau2,Florence Pojer2, David Hacker2, Anna Marchetti1

1 Geneva Antibody Facility, Faculty of Medicine, University of Geneva, 1 rue Michel Servet, CH-1211, Geneva, Switzerland

2 Protein Production and Structure Core Facility, EPFL, SV, Station 19, CH-1015, Lausanne, Switzerland

Abstract

The recombinant antibody RB596 detects by ELISA the spike S protein from SARS-CoV-2.

Introduction

The spike (S) glycoprotein mediates attachment of coronaviruses to the host ACE2 receptor (through the Receptor-Binding Domain [RBD] in the S1 subunit) and fusion with the host cell membrane (through the S2 subunit) (Yan et al., 2020). Here we describe the ability of the recombinant antibody RB596 to detect by ELISA the soluble ectodomain of the S protein from SARS-CoV-2 (UniProt P0DTC2).

Materials & Methods

Antibodies: ABCD_RB596 antibody (ABCD nomenclature, https://web.expasy.org/abcd/) was produced by the Geneva Antibody Facility (http://www.unige.ch/medecine/antibodies/) as a mini- antibody with the antigen-binding VHH portion fused to a mouse IgG2A Fc. HEK293 suspension cells (growing in FreeStyle™ 293 Expression Medium, Gibco #12338) were transiently transfected with the vector coding for the VHH-Fc. Supernatant (100 mg/L) was collected after 5 days.

Antigen: The antibody was raised against the ectodomain (residues 1-1208) of the SARS-CoV-2 S protein, with a KV->PP substitution at residues 986/987, a RRAR-

>GSAS substitution at residues 682-685, and C-terminal T4 fibritin trimerization motif, protease cleavage site, TwinStrepTag and 8xHisTag (PDB #6VSB; Wrapp et al., 2020). As a negative control, an irrelevant protein (GOLPH3, Golgi phosphoprotein 3, UniProt Q9H4A6), also containing the TwinStrep and 8xHis tags, was used.

Protocol: Antigen proteins (10 µg/ml, 50 µl/well in PBS 0.5% (w/v) BSA, 0.1% (w/v) Tween20) were immobilized on streptavidin-coated ELISA plates (Pierce #15124) for 30 min. Each well was rinsed three times with 100 µl of washing buffer (PBS + 0.5% (w/v) BSA + 0.05% (w/v) Tween20), then incubated for 1 hour with 50 µl of RB596 supernatant diluted in washing buffer (Fig. 1). After rinsing 3 times (100 µl washing buffer), wells were incubated with horseradish peroxidase-coupled goat anti- mouse IgG (Bio-Rad #170-6516, dilution 1:1000, 50 µl per well) for 30 min. After 3 rinses, Tetramethylbenzidine (TMB) substrate (Sigma #T5569) was added (50 µl per well). The reaction was stopped by the addition of 25 µl of 2 M H2SO4. The absorbance (OD) was measured at 450 nm, and the absorbance at 570 nm was subtracted.

Results

The RB596 antibody bound in a concentration-dependent manner to the SARS-CoV-2 S protein, but not to an unrelated tagged protein (Fig. 1). This antibody has also been shown to recognize the full-length SARS-CoV-2 S protein by immunofluorescence (Marchetti et al., 2020).

Fig. 1. Specific binding of RB596 to the SARS-CoV-2 S protein, but not to the negative control protein, as detected by ELISA.

References

Marchetti A, Hammel P, Zenhausern F. AI334, AQ806 and RB596 antibodies recognize the spike S protein from SARS-CoV-2 by immunofluorescence. Antib. Rep. 2020, 3:e219. doi:10.24450/journals/abrep.2020.e219

Wrapp D, Wang N, Corbett KS, et al. Cryo-EM structure of the 2019-nCoV spike in the prefusion conformation.

Science 2020; 367:1260-1263. PMID:32075877

Yan R, Zhang Y, Li Y, Xia L, Guo Y, Zhou Q. Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science 2020; 367:1444-1448.

PMID:32132184

Acknowledgments

We would like to thank Prof. Jason McLellan (University of Texas, Austin) for providing the Spike expressing construct; Prof. Giovanni D'Angelo for the GolPh3 expressing construct; and Laurence Durrer and Soraya Quinche (Protein Production and Structure Core Facility, EPFL) for the help with the mammalian cell culture.

Conflict of interest

The authors declare no conflict of interest.

0.00 0.05 0.10 0.15 0.20

1:10 1:100 1:1000

ELISA Signal (OD)

Antibody Dilution Control

RB596

Références

Documents relatifs

Potent neutralization of severe acute respiratory syndrome (SARS) coronavirus by a human mAb to S1 protein that blocks receptor association.. Proc Natl Acad

As a negative control, an N-biotinylated peptide corresponding to the last 33 C-terminal residues ( DSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ ) of the SARS- CoV-2 M protein

The recombinant antibodies AI334 and AQ806 detect by immunofluorescence the spike S protein from SARS-CoV-2.. MARCHETTI, Anna,

Three recombinant antibodies (AI334, AQ806 and RB596) successfully detect by immunofluorescence the S protein from SARS-CoV-2 (UniProt P0DTC2) expressed in Vero- B4

AL626 labeled the plasma membrane of HeLa cells expressing the ALFA-tagged TAC protein (in white); the signal co-localized (arrows) with the signal generated by the anti-TAC

The antibody RB487 bound in a concentration-dependent manner to the WBP1 peptide against which they were raised (KKLETFKKTN), but not to the negative control

The recombinant antibody RB596 recognizes a linear epitope (residues 973-984, ISSVLNDILSRL) from the SARS-CoV-2 spike S protein.. FARRERA SOLER, Lluc,

AR222, AR249, AS274, AS702 and AS708 antibodies recognize the spike S protein from SARS-CoV-2 by ELISA.. HAMMEL, Philippe, MARCHETTI, Anna,