• Aucun résultat trouvé

Yeast sphingolipids do not need to contain very long chain fatty acids

N/A
N/A
Protected

Academic year: 2022

Partager "Yeast sphingolipids do not need to contain very long chain fatty acids"

Copied!
3
0
0

Texte intégral

(1)

33

Supplemental material Figure legends

Figure S1. IPCs of 2∆.Lass5 and 4∆.Lass5 mostly contain C16:0 and C18:0 fatty acids by ESI-MS. A, YPK9 wt and 4∆.Lass5 were grown exponentially in LM (met-),

glycerophospholipids and IPCs were extracted using CHCl3-CH3OH (1:1), and the desalted lipid extract was analyzed by ESI-MS on a Bruker 4.7 T BioAPEX II FT/ICR mass

spectrometer in the negative ion mode. For sphingolipids, two consecutive numbers separated by a dash indicate the number of C atoms in the fatty acid moiety (based on the assumption that the LCB contains the usual 18 C atoms) and the number of hydroxyls in the entire ceramide moiety. For glycerophospholipids the sum of C atoms and double bonds in the two fatty acids is indicated in parenthesis. The same results were obtained when the samples were analyzed on a Bruker Daltonics mass spectrometer. B, 2∆.Lass5 cells were grown and lipids were analyzed as for panel A, either before or after deacylation with NaOH. The

concentration of lipids in the NaOH treated sample was 10 fold higher than in the control sample. The figure shows one of several concordant experiments, in which deacylated as well as crude lipid extracts were analyzed. In experiments of the type shown here, the DHS-based IPCs (having only 2 hydroxyl groups) were much more abundant than IPCs with 3 or 4 hydroxyls, quite in contrast to the experiment shown in Fig. 4A. The difference could be related to the extraction procedure or the different ESI-MS technology used.

Figure S2. Bud site selection is normal in 4∆.Lass5 and 4∆.Lass5 elo3∆ cells. Cells were maintained in exponential growth phase for at least ten cell divisions, stained with calcofluor white and viewed under the light microscope.

(2)

Cerantola et al., Figure 4

760.51 PS (34:1)

908.61

0.5 1.0 1.5 2.0

a.i. x 10-6

7008009001100m/z

WT (YPK9)

924.65 952.68 936.61

812.53 IPC16-4 824.56 IPC18-3 780.54 IPC16-2

3.0

700m/z

a.i x 10-6

4∆.Lass5

2.0 1.0

900

714.51 PE (34:2) 753.45 PI (28:0)

796.53 IPC16-3 807.50 PI (32:1)

800

835.53 (PI 34:1)

863.54 PI (36:1) PI 36:1 (863.56)

IPC24-3 IPC24-4

IPC26-4 IPC26-3

A

a.i. x 10-6

865.58 PI (36:0)

863.56 PI (36:1)

1.0 2.0 3.0 4.0 5.0

700800900m/z

714.51 PE (34:2)

807.50 PI (32:1)

835.53 PI (34:1) 780.53 IPC16-2

2.0 1.0 3.0 4.0 5.0

a.i. x 10-6

796.53 IPC16-3

700800900m/z

752.51 IPC14-2

812.53 IPC16-4 824.56 IPC18-3

840.57 IPC18-4

842.59 mannosyl-IPC16-2

B

2∆.Lass5, control 2∆.Lass5, NaOH treated

Cerantola et al., Figure S1

(3)

YPK9

4∆.Lass5

4∆.Lass5 elo3∆

elo3∆-2 (YPK11)

Cerantola et al., Figure S2

elo3∆-1 (BY4742)

Références

Documents relatifs

[r]

HsCerS3 PTIKWSDLED-HDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFVASPLAKSFGIKETVRK HsCerS4 PNVTWTELED-RDGRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGVRDQTRR HsCerS5

54.was / were there many people at the party?. 55.was / were the girls in

Le nylon 6-10 est obtenu à partir d'une réaction de polymérisation entre le chlorure de décanedioyle et le 1,6-diaminohexane4. Sa molécule comporte le

Déterminer la fonction dérivée des fonctions suivantes en ayant précisé auparavant l'ensemble sur lequel f

As shown in Figure 3(A), the sphingolipid profile of 4.Lass5 lip1 was similar to the one of 4.Lass5 (Figure 3A, lanes 3 and 5), and quantitation by radioscanning of TLC plates in

Synthesis of Sphingolipids with Very Long Chain Fatty Acids but Not Ergosterol Is Required for Routing of Newly Synthesized Plasma Membrane ATPase to the Cell Surface of

Morphological analysis of a conditional yeast mutant in acetyl- CoA carboxylase acc1 ts /mtr7, the rate-limiting enzyme of fatty acid synthesis, suggested that the synthesis of C