• Aucun résultat trouvé

Tactical sciences for plant viruses to foster food security: the potato case

N/A
N/A
Protected

Academic year: 2021

Partager "Tactical sciences for plant viruses to foster food security: the potato case"

Copied!
23
0
0

Texte intégral

(1)

IL

VO

Tactical sciences for plant viruses to foster

food security: the potato case

Prof. Sébastien Massart –

Gembloux Agro-Bio Tech – Liege University

Dr. Kris De Jonghe

– ILVO Plant Sciences

ILVO

Belgian scientific plant health symposium

15/10/2020 - Online

VO

Food security and plant pathogens/pests in 2020

for a fair, healthy and environmentally-friendly food system

Healthy production

Healthy environment

Healthy processing

Healthy consumption

(2)

IL

VO

Plant health in 2020, the covid-19 year

Article https://www.health.belgium.be/nl/news/de-overdracht-van-ziekten-bestrijden-overeenkomsten-tussen-mens-en-plant

(3)

IL

VO

Plant Health threats

 Well-known established, yet continuous threats

Phytophthora infestans – late blight in potato

 New emerging threats

Changing conditions, changing food consumption patterns, etc.

‘Candidatus Liberibacter solanacearum’ - zebra chip

 Introduced threats

Globalisation & international trade

Sweet potato diseases

IL

VO

Food safety & (bio)security

It starts at the ports of entry

© U.S. Customs and Border Protection

Photo credits: favv; landbouwleven,

© msc © wallonia.be

(4)

IL

VO

Food safety & (bio)security

Phytosanitary risks by “uncontrolled” introductions

E-commerce as a pest pathway

 Internet is a convenient means for products to bypass the

application of phytosanitary measures or scrutiny through PRA

 Few NPPOs used to factor this pathway into their risk analyses

 There is no effective mechanism for detecting products holding

phytosanitary risks sold online

How to deal with this ??

Books infused with seeds Bulbs

Wild flower seeds Seed/fertilizer/mulch mix

Dirty camping gear & trekking clothes

Food safety & (bio)security

(5)

IL

VO

Food safety & (bio)security

We are also to blame !

© US Department of Agriculture

© farmonline.com © ABC Rural: Babs McHugh

www.kallus.com/packing/index.htm

VO

EPPO campaign

(6)

IL

VO

Food safety & (bio)security

Self-sustainable

long-term

network

that supports

coordination

and

collaboration

in the area of

phytosanitary research

Food safety & (bio)security

Tactical sciences ?

Innovative diagnostics

Survey from citizen to lab

Pest risk analysis Training professionals Pathogen characterization Trans-national network

Generating knowledge and

information on how crises

can emerge and evolve and

how they can be

anticipated, resolved or

(7)

IL

VO

routine plant virus diagnostics

ELISA Q(RT-)PCR (RT-)PCR Mechanical inoculation on indicator plants Electron microscopy TEM - SEM

LAMP (Loop mediated isothermal amplification)

1. The rise of sequencing technologies

VO

Sequencing nucleic acids from 2000 to 2020 ?

1. The rise of sequencing technologies

(8)

IL

VO

Pay only 0.001 %

of original genome

price

Sequencing nucleic acids from 2000 to 2020 ?

1. The rise of sequencing technologies

What are the scientists doing?

(9)

IL

VO

Genomes & Pathogens ?

1. The rise of sequencing technologies

VO

Genomes of known plant pests ?

Potato virus Y : - 460 full genomes (10 kb)

- 3,300 sequences

1. The rise of sequencing technologies

Traceback the origin and timing of emergence of the different

strains (O, N…)

Show that human activities have shaped the diversity of PVY

Ralstonia solanacearum species complex

- 102 full genomes (5.8 Mb)

- 42,000 sequences

(10)

IL

VO

Genomes of known plant pests ?

Potato virus Y : - 460 full genomes

- 3,300 sequences

1. The rise of sequencing technologies

Belgium: Strain differentiation in

support of seed potato certification

• Since 1984, first description of the mild PVY Wilga recombinant strain in Poland

• Since than, gradual increase in importance.

• Currently NTN and N-Wilga most important strains in Europa and Belgium

Belgium

Source: Bahrami et al. 2014

1. The rise of sequencing technologies

2016 – FAO-WHO

Genome sequencing is potentially a powerful tool in all relevant sectors in food, public health and animal/ plant health. Strong relevance to a One Health approach.

(11)

IL

VO

1. The rise of sequencing technologies

From Research to diagnostics :

2020 :

VO

Hundreds of new viruses discovered

Viruses and viroids on Prunus sp.

30ies 40ies 50ies 60ies 70ies 80ies 90ies 2000 2010

39 (0.6 per year) 8 (1.6) 9 (4.5)

1. The rise of sequencing technologies

>>>

(12)

IL

VO

2. Risks posed by new viruses ?

Which one of the new plant viruses represents a risk for plant trade and production ? Preliminary - Confirmation - Taxonomy - Sample information - Bibliography Intermediate - Full genome - Diagnostic - Local prevalence Long term - Koch postulate - Host range - Vector - Large survey

Stakeholder consultations and prioritisation

(13)

IL

VO

2. Risks posed by new viruses ?

Which one of the new plant viruses represents a risk for plant trade and production ?

Discovery of a new potyvirus on breeding line of potato

Host range of PYBV similar to PVA (solanaceous and indicator plants)

Screening commercial seeds during 5 years: no detection

Not the highest risk ?

VO 0,00E+00 5,00E+07 1,00E+08 1,50E+08 2,00E+08 2,50E+08 D ec 1 98 2 no v-84 Au g 19 86 se pt -8 7 oc t-88 D ec 1 98 9 m ar s-91 Ju n 19 92 Ju n 19 93 Ap r 1 99 4 Fe b 19 95 D ec 1 99 5 oc t-96 Au g 19 97 Ju n 19 98 Ju n 19 99 Ap r 2 00 0 Fe b 20 01 D ec 2 00 1 oc t-02 Au g 20 03 Ju n 20 04 Ap r 2 00 5 Fe b 20 06 D ec 2 00 6 oc t-07 Au g 20 08 Ju n 20 09 Ap r 2 01 0 Fe b 20 11 D ec 2 01 1 oc t-12 Au g 20 13 Ju n 20 14 Ap r 2 01 5 Fe b 20 16 D ec 2 01 6 oc t-17 Au g 20 18 Ju n 20 19 Ap r 2 02 0

Sequences available in Genbank database

1 week 2020 || 1982-1997

(14)

IL

VO

3. Bioinformaticians: the new stakeholder

Impact of data analysis on pest detection ?

 A potato sample from Peru was sequenced and 2 viruses identified: PVX and a new nepovirus (not present in database and further identified as PVB)

 Two other samples: Grapevine and apple

 Identical datasets(10)sent to 13 laboratories(double blind test) -> application of bioinformatics tools to identify viruses present in the sample

 Worst case scenario (less sequences than expected – down to 50,000)

3. Bioinformaticians: the new stakeholder

Impact of data analysis on pest detection ?

labID Sensitivity 50,000 250,000 2,500,000 Average A 10% 53% 90% 51% B 30% 35% 80% 46% C 60% 71% 80% 70% D 50% 82% 100% 78% E 30% 82% 80% 68% F 80% 88% 100% 89% G 20% 53% 100% 57% H 30% 65% 70% 57% J 70% 94% 100% 89% K 40% 71% 90% 68% M 50% 94% 90% 81% N 30% 82% 90% 70% O 20% 41% 40% 35% P 20% 59% 70% 51% R 100% 100% 100% 100% S 50% 100% 100% 86% T 90% 100% 100% 97% V 60% 88% 80% 78% W1 40% 82% 90% 73% W2 60% 82% 90% 78% X 30% 71% 80% 62%

70 % sensitivity overall

Huge differences between laboratories

Sensitivity increased with sequencing

depth and quantity of sequences from

the viral species

(15)

IL

VO

3. Bioinformaticians: the new stakeholder

Impact of data analysis on pest detection ?

Ability to detect the virus was reduced for the

unknown virus compared to PVX or GLRaV-1

Bioinformatics has a tremendous impact on

virus detection

VO

1. Develop training material

2. Bioinformatics challenge on HTS data

3. Data mining

Euphresco

project (15 partners + 13 associated partners) Coordination: A. Haegeman (ILVO)

The Plant Health Bioinformatic Network (PHBN)

Seed for networking the new stakeholder

3. Bioinformaticians: the new stakeholder

(16)

IL

VO

3. Bioinformaticians: the new stakeholder

Guiding PRA by genome sequences ?

Predicting the hosts and the vectors of mamalian viruses thanks to the

genome sequence ?

Predictive accuracy : 72% for reservoir host & 99% for vector group

3. Bioinformaticians: the new stakeholder

Guiding PRA by genome sequences

GENOPREDICT concept for plant viruses

1) Function

2) Signature (amino acids)

TGAATGAGGATGAGGAAAAATGTCCATAC GTGCTATGCCGCTTTCCACTTCTCTGAGA ACCTGCTTCTTGATTTCGTAGAA ILKYVCKTYFPASNREVYMKEFLVTRVNTW FCKFSRIDTFLLYKGVAHKSVDSEQFY

Genomes

Proteins

Protein information

= Modules

+ transmission & host range

(17)

IL

VO

Data Mining & Machine learning algorithms

Interesting results & variable depending on the biological

properties

Sensitivity >> specificity (risk of FP > FN)

PhD of Rachid Tahzima finishing & ongoing story

3. Bioinformaticians: the new stakeholder

Guiding PRA by genome sequences

What about plant viruses ?

VO

HTS as an untargeted diagnostic tool for virus screening

Plantentuin Meise

A case study for the identification of new harmful plant

viruses in

Solanaceae

in Belgium

SEVIPLANT (RT 18/3)

(18)

IL

VO

National project to scan the

virome of commodities

SEVIPLANT

17,000 samples of Solanaceae

High Throughput Sequencing

Crops: potato, tomato, eggplant, pepper..

Wild: black nightshade, Datura, etc

Ornamental:

Petunia, Brugmansia, etc

National survey of viruses infecting solanaceae

“Solanaceae Virus Wikipedia”

4. SEVIPLANT project

(19)

IL

VO

1,300 samples sequenced

10 viral species detected

5 new species for Belgium

New host for 3 viruses

Physostegia chlorotic mottle virus

4. SEVIPLANT project

VO

PhCMoV: informal EU network

4. SEVIPLANT project

Present in many countries & from 20 years

Host range expansion Low diversity

(20)

IL

VO

Plantentuin Meise

Status of ‘Ca. Liberibacter solanacearum’ and phytoplasma

in carrot and potato

Sampling in potato Sampling in carrot

Sampling in both potato & carrot Fyliber(RF14/6290) & VECTRACROP (2015 –D -168)

Trans-national network

5. Surveys and status projects

Phytosanitary risks of new crops in Belgian horticulture

Increasing interest in growing and commercializing new crops, including some “forgotten” crops. => eg. tuber crops => no info on phytosanitary status & mostly vegetatively propagated

niche markets & “short chain circuits” - eg CSA farms

Examples: Yacon, ulluco, sweet potato, crosne, mashua, oca (new crops) and Jerusalem artichoke (forgotten crop)

National project (2 partners; ILVO & PCG) Transnational project (7 partners)

RISK for our potato crops ?

PRONC – BE (2018-A-293) Trans-national

network

6. PRONC project

Trans-national

(21)

IL

VO

Phytosanitary risks of new crops in Belgian horticulture

National project (2 partners; ILVO & PCG)

Transnational project (7 partners) PRONC – BE (2018-A-293)

 Where are these new crops cultured in Belgium, what are the varieties and how is the planting material distributed?

 What is the origin of planting materials of new crops?

 Which viruses and nematodes are associated with propagation materials and marketed new crops?  What are the phytosanitary risks of these organisms? Biological characterization

 Which phytosanitary measures can reduce the introduction and distribution of some of these new plant pathogens?

Focus national project: VIRUSES & NEMATODES

6. PRONC project

Trans-national

network

VO

7. Training professionals

• Sampling

• Identity and regulation

• Biology & epidemiology of diseases/pests

Symptomatology Georgraphic distribution Host range Training professionals

Inspection services

(22)

IL

VO

Facilitate collaboration amongst institutes around the world,

Focus on linking botanic gardens and arboreta, National Plant Protection Organisations (NPPOs) and plant health scientists.

Botanical gardens and arboreta

The Belgian Plant Sentinel network (BE-PSN) The International Plant Sentinel Network (IPSN)

• Trainings & workshops • Surveys • Database Training professionals Trans-national network

7. Training professionals

Tactical sciences for plant viruses to foster food security

Innovative

diagnostics

Survey from citizen to lab

Pest risk analysis Training professionals Pathogen characterization Trans-national network

Technological innovation brings new

tools and generates new knowledge

Integration of these tools and knowledge

improve Plant Health management

Optimizing resource utilisation

International networks like Euphresco

build synergies and accelerate diffusion

of innovation

(23)

IL

VO

Prof. Sébastien Massart –

Gembloux Agro-Bio Tech – Liege University

Dr. Kris De Jonghe

– ILVO Plant Sciences

ILVO

Références

Documents relatifs

Our hypothesis is that in the staple food chain the introduction of tested appropriated technologies near production areas must reduce postharvest losses and increase the food

Epidemiologic research has demonstrated solid evidence linking the prototypical North American diet—high in refined sugar, animal fat, and animal protein—to obe- sity,

All rights are reserved by the Publisher, whether the whole or part of the material is concerned, speci fi cally the rights of translation, reprinting, reuse of

In this paper we outline how a portfolio of life science related pro- jects at the National e-Science Centre (NeSC) at the University of Glasgow have

(d) Percentage increase in the average beneficiary walking time when minimizing a single-objective func- tion (case 1) as opposed to the total welfare cost (Model 1), as a function

The main objectives of agricultural policies in Turkey, as set out in the Government's Five-Year Development Plans: (i) to meet the nutritional needs of

With respect to the impact of the food aid on the nutritional status, food consumption and household vul- nerability, this study suggests that programs aimed at

Food security is an issue for individuals within households, for households as a whole, for nations and for the international community. At household level,